Lineage for d3e0ia_ (3e0i A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.10: Aldolase [51569] (9 families) 
Common fold covers whole protein structure
Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) 
Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (5 species) Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries) 
Domain d3e0ia_: 3e0i A: [174433]
automated match to d1pe1a_
complexed with cu, pep, po4
Details for d3e0ia_
PDB Entry: 3e0i (more details), 1.7 Å
PDB Description: Cu2+ substituted Aquifex aeolicus KDO8PS in complex with PEP
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolaseSCOPe Domain Sequences for d3e0ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e0ia_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti
SCOPe Domain Coordinates for d3e0ia_:
Click to download the PDB-style file with coordinates for d3e0ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3e0ia_:
- d3e0ia_ first appeared in SCOPe 2.01
- d3e0ia_ appears in SCOPe 2.06
- d3e0ia_ appears in the current release, SCOPe 2.08
View in 3D
