Lineage for d3dj1b_ (3dj1 B:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily)
contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helixSuperfamily b.36.1: PDZ domain-like [50156] (7 families) 
peptide-binding domain
Family b.36.1.0: automated matches [191362] (1 protein)
not a true familyProtein automated matches [190436] (5 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [189959] (12 PDB entries) 
Domain d3dj1b_: 3dj1 B: [231998]
automated match to d3dj3b_
complexed with so4
Details for d3dj1b_
PDB Entry: 3dj1 (more details), 1.8 Å
PDB Description: crystal structure of TIP-1 wild type
PDB Compounds: (B:) tax1-binding protein 3SCOPe Domain Sequences for d3dj1b_:
Sequence, based on SEQRES records: (download)
>d3dj1b_ b.36.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeia
glqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqqsml
Sequence, based on observed residues (ATOM records): (download)
>d3dj1b_ b.36.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tavvqrveihklrqgenlilgfsigggidqdpsqnpfsdkgiyvtrvseggpaeiaglqi
gdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqqsml
SCOPe Domain Coordinates for d3dj1b_:
Click to download the PDB-style file with coordinates for d3dj1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3dj1b_:
- d3dj1b_ first appeared in SCOPe 2.03
- d3dj1b_ appears in SCOPe 2.05
- d3dj1b_ appears in the current release, SCOPe 2.08
View in 3D
