Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (27 species) not a true protein |
Species Bacillus anthracis [TaxId:260799] [188005] (2 PDB entries) |
Domain d3data_: 3dat A: [173791] automated match to d1draa_ complexed with mtx, ndp |
PDB Entry: 3dat (more details), 2.3 Å
SCOPe Domain Sequences for d3data_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3data_ c.71.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 260799]} mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekq
Timeline for d3data_: