Lineage for d3d8va1 (3d8v A:1-263)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the restSuperfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) 
Family c.68.1.0: automated matches [191551] (1 protein)
not a true familyProtein automated matches [190951] (20 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:1773] [224907] (7 PDB entries) 
Domain d3d8va1: 3d8v A:1-263 [209042]
Other proteins in same PDB: d3d8va2
automated match to d1hm9a2
complexed with ud1
Details for d3d8va1
PDB Entry: 3d8v (more details), 2.55 Å
PDB Description: Crystal structure of GlmU from Mycobacterium tuberculosis in complex with uridine-diphosphate-N-acetylglucosamine
PDB Compounds: (A:) Bifunctional protein glmUSCOPe Domain Sequences for d3d8va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d8va1 c.68.1.0 (A:1-263) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdh
qriaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtpllda
dtladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirev
nagvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnn
rvqlaelaselnrrvvaahqlag
SCOPe Domain Coordinates for d3d8va1:
Click to download the PDB-style file with coordinates for d3d8va1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3d8va1:
- d3d8va1 is new in SCOPe 2.03-stable
- d3d8va1 appears in SCOPe 2.04
- d3d8va1 appears in the current release, SCOPe 2.08
View in 3D
