Lineage for d3d31a2 (3d31 A:1-229)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478252Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2478530Protein Sulfate/molybdate ABC transporter, ATP-binding protein [159573] (1 species)
  7. 2478531Species Methanosarcina acetivorans [TaxId:2214] [159574] (1 PDB entry)
    Uniprot Q8TTZ3 1-229
  8. 2478532Domain d3d31a2: 3d31 A:1-229 [157262]
    Other proteins in same PDB: d3d31a1, d3d31b1, d3d31b2, d3d31c1, d3d31d1
    complexed with wo4

Details for d3d31a2

PDB Entry: 3d31 (more details), 3 Å

PDB Description: modbc from methanosarcina acetivorans
PDB Compounds: (A:) Sulfate/molybdate ABC transporter, ATP-binding protein

SCOPe Domain Sequences for d3d31a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}
mieieslsrkwknfsldnlslkvesgeyfvilgptgagktlfleliagfhvpdsgrilld
gkdvtdlspekhdiafvyqnyslfphmnvkknlefgmrmkkikdpkrvldtardlkiehl
ldrnpltlsggeqqrvalaralvtnpkillldeplsaldprtqenaremlsvlhkknklt
vlhithdqtearimadriavvmdgkliqvgkpeeifekpvegrvasfvg

SCOPe Domain Coordinates for d3d31a2:

Click to download the PDB-style file with coordinates for d3d31a2.
(The format of our PDB-style files is described here.)

Timeline for d3d31a2: