Lineage for d3d1ga1 (3d1g A:1-122)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583356Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 2583357Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. 2583358Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
    Uniprot P00583
  8. 2583401Domain d3d1ga1: 3d1g A:1-122 [157200]
    automated match to d1ok7a1
    complexed with 322

Details for d3d1ga1

PDB Entry: 3d1g (more details), 1.64 Å

PDB Description: structure of a small molecule inhibitor bound to a dna sliding clamp
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d3d1ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d1ga1 d.131.1.1 (A:1-122) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
dw

SCOPe Domain Coordinates for d3d1ga1:

Click to download the PDB-style file with coordinates for d3d1ga1.
(The format of our PDB-style files is described here.)

Timeline for d3d1ga1: