![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
![]() | Protein automated matches [190229] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187292] (101 PDB entries) |
![]() | Domain d3b26a_: 3b26 A: [197368] automated match to d3r4pb_ complexed with b2l |
PDB Entry: 3b26 (more details), 2.1 Å
SCOPe Domain Sequences for d3b26a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b26a_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt eyleerrikeivkkhsqfigypitlfvek
Timeline for d3b26a_: