Lineage for d2yprb_ (2ypr B:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.21: ets domain [46859] (9 proteins) 
Protein automated matches [191121] (2 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries) 
Domain d2yprb_: 2ypr B: [193284]
automated match to d1flia_
complexed with gol
Details for d2yprb_
PDB Entry: 2ypr (more details), 2.64 Å
PDB Description: crystal structure of the dna binding ets domain of human protein fev
PDB Compounds: (B:) protein fevSCOPe Domain Sequences for d2yprb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yprb_ a.4.5.21 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qiqlwqfllelladranagciawegghgefkltdpdevarrwgerkskpnmnydklsral
ryyydknimskvhgkryayrfdfqglaqacqp
SCOPe Domain Coordinates for d2yprb_:
Click to download the PDB-style file with coordinates for d2yprb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2yprb_:
- d2yprb_ first appeared in SCOPe 2.02
- d2yprb_ appears in SCOPe 2.06
- d2yprb_ appears in the current release, SCOPe 2.08
View in 3D
