Lineage for d2wnvb_ (2wnv B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2386845Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2387221Protein automated matches [190204] (3 species)
    not a true protein
  7. 2387222Species Human (Homo sapiens) [TaxId:9606] [186956] (14 PDB entries)
  8. 2387226Domain d2wnvb_: 2wnv B: [169490]
    Other proteins in same PDB: d2wnva_, d2wnvc_, d2wnvd_, d2wnvf_
    automated match to d1pk6b_
    complexed with 2dr, ca, nag

Details for d2wnvb_

PDB Entry: 2wnv (more details), 1.25 Å

PDB Description: complex between c1q globular heads and deoxyribose
PDB Compounds: (B:) complement c1q subcomponent subunit b

SCOPe Domain Sequences for d2wnvb_:

Sequence, based on SEQRES records: (download)

>d2wnvb_ b.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpdm

Sequence, based on observed residues (ATOM records): (download)

>d2wnvb_ b.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtivplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrgn
lcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmegan
sifsgfllfpdm

SCOPe Domain Coordinates for d2wnvb_:

Click to download the PDB-style file with coordinates for d2wnvb_.
(The format of our PDB-style files is described here.)

Timeline for d2wnvb_: