Lineage for d2weia_ (2wei A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1436359Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1436360Protein automated matches [190417] (18 species)
    not a true protein
  7. 1436467Species Cryptosporidium parvum [TaxId:353152] [196400] (5 PDB entries)
  8. 1436468Domain d2weia_: 2wei A: [206777]
    automated match to d2qkra_
    complexed with vgg

Details for d2weia_

PDB Entry: 2wei (more details), 1.65 Å

PDB Description: crystal structure of the kinase domain of cryptosporidium parvum calcium dependent protein kinase in complex with 3-mb-pp1
PDB Compounds: (A:) calmodulin-domain protein kinase 1, putative

SCOPe Domain Sequences for d2weia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2weia_ d.144.1.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
sgrenlyfqgtfaerynivcmlgkgsfgevlkckdritqqeyavkvinkasaknkdtsti
lrevellkkldhpnimklfeiledsssfyivgelytggelfdeiikrkrfsehdaariik
qvfsgitymhkhnivhrdlkpenilleskekdcdikiidfglstcfqqntkmkdrigtay
yiapevlrgtydekcdvwsagvilyillsgtppfygkneydilkrvetgkyafdlpqwrt
isddakdlirkmltfhpslritatqclehpwiqkysse

SCOPe Domain Coordinates for d2weia_:

Click to download the PDB-style file with coordinates for d2weia_.
(The format of our PDB-style files is described here.)

Timeline for d2weia_: