Lineage for d2v8ta_ (2v8t A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (10 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins)
automatically mapped to Pfam PF05067Protein automated matches [190575] (2 species)
not a true proteinSpecies Thermus thermophilus [TaxId:262724] [188041] (3 PDB entries) 
Domain d2v8ta_: 2v8t A: [168377]
automated match to d2cwla1
complexed with cl, li, mn, so4
Details for d2v8ta_
PDB Entry: 2v8t (more details), 0.98 Å
PDB Description: crystal structure of mn catalase from thermus thermophilus complexed with chloride
PDB Compounds: (A:) manganese-containing pseudocatalaseSCOPe Domain Sequences for d2v8ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v8ta_ a.25.1.3 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}
mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
dlianiateelghielvaatinsllaknpgkdleegvdpastplgfakdvrnaahfiagg
anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakklyek
ak
SCOPe Domain Coordinates for d2v8ta_:
Click to download the PDB-style file with coordinates for d2v8ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2v8ta_:
- d2v8ta_ first appeared in SCOPe 2.01
- d2v8ta_ appears in SCOPe 2.07
View in 3D
