Lineage for d2rg1b_ (2rg1 B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.8: WrbA-like [117474] (3 proteins) 
Protein Trp repressor binding protein WrbA [117475] (4 species) 
Species Escherichia coli [TaxId:562] [188617] (3 PDB entries) 
Domain d2rg1b_: 2rg1 B: [168110]
automated match to d1zwka1
complexed with cl
Details for d2rg1b_
PDB Entry: 2rg1 (more details), 1.85 Å
PDB Description: crystal structure of e. coli wrba apoprotein
PDB Compounds: (B:) Flavoprotein WrbASCOPe Domain Sequences for d2rg1b_:
Sequence, based on SEQRES records: (download)
>d2rg1b_ c.23.5.8 (B:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 562]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng
Sequence, based on observed residues (ATOM records): (download)
>d2rg1b_ c.23.5.8 (B:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 562]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetqtapvatpqeladydaiif
gtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqeqtitstwttlahh
gmvivpigyagtpygattiaqpsqeelsiaryqgeyvaglavklng
SCOPe Domain Coordinates for d2rg1b_:
Click to download the PDB-style file with coordinates for d2rg1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rg1b_:
- d2rg1b_ first appeared in SCOPe 2.01
- d2rg1b_ appears in SCOPe 2.06
- d2rg1b_ appears in the current release, SCOPe 2.08
View in 3D
