Lineage for d2reta1 (2ret A:30-110)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548248Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2548249Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2548338Family d.24.1.7: GSPII I/J protein-like [160135] (2 proteins)
    Pfam PF02501
  6. 2548339Protein Pseudopilin EpsI [160136] (1 species)
  7. 2548340Species Vibrio vulnificus [TaxId:672] [160137] (2 PDB entries)
    Uniprot Q7MPZ1 63-143
  8. 2548345Domain d2reta1: 2ret A:30-110 [151983]
    Other proteins in same PDB: d2reta2, d2retb1, d2retc3, d2retd_, d2rete3, d2retf_, d2reth_
    complexed with cl, na

Details for d2reta1

PDB Entry: 2ret (more details), 2.21 Å

PDB Description: the crystal structure of a binary complex of two pseudopilins: epsi and epsj from the type 2 secretion system of vibrio vulnificus
PDB Compounds: (A:) Pseudopilin EpsI

SCOPe Domain Sequences for d2reta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2reta1 d.24.1.7 (A:30-110) Pseudopilin EpsI {Vibrio vulnificus [TaxId: 672]}
tvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllkaf
dvsvaattqaspiitvrsyva

SCOPe Domain Coordinates for d2reta1:

Click to download the PDB-style file with coordinates for d2reta1.
(The format of our PDB-style files is described here.)

Timeline for d2reta1: