Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) |
Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins) Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain |
Protein Hypothetical protein HI0107 [160827] (1 species) |
Species Haemophilus influenzae [TaxId:727] [160828] (1 PDB entry) Uniprot Q57017 343-420 |
Domain d2o1ra1: 2o1r A:1-78 [148549] complexed with edo, peg |
PDB Entry: 2o1r (more details), 1.52 Å
SCOP Domain Sequences for d2o1ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o1ra1 d.145.1.4 (A:1-78) Hypothetical protein HI0107 {Haemophilus influenzae [TaxId: 727]} iqqsdgsmiidgsanlrdlnkmfnweldtedartfnglilehleeipdegticeidglli tilevgdnmikqakvvkl
Timeline for d2o1ra1: