Lineage for d2o1ra1 (2o1r A:1-78)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875230Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 875231Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) (S)
  5. 875354Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 875377Protein Hypothetical protein HI0107 [160827] (1 species)
  7. 875378Species Haemophilus influenzae [TaxId:727] [160828] (1 PDB entry)
    Uniprot Q57017 343-420
  8. 875379Domain d2o1ra1: 2o1r A:1-78 [148549]
    complexed with edo, peg

Details for d2o1ra1

PDB Entry: 2o1r (more details), 1.52 Å

PDB Description: Structural Genomics, the crystal structure of a conserved putative protein from Haemophilus influenzae Rd KW20
PDB Compounds: (A:) UPF0053 protein HI0107

SCOP Domain Sequences for d2o1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o1ra1 d.145.1.4 (A:1-78) Hypothetical protein HI0107 {Haemophilus influenzae [TaxId: 727]}
iqqsdgsmiidgsanlrdlnkmfnweldtedartfnglilehleeipdegticeidglli
tilevgdnmikqakvvkl

SCOP Domain Coordinates for d2o1ra1:

Click to download the PDB-style file with coordinates for d2o1ra1.
(The format of our PDB-style files is described here.)

Timeline for d2o1ra1:

  • d2o1ra1 is new in SCOP 1.75
  • d2o1ra1 does not appear in SCOPe 2.01