PDB entry 2o1r

View 2o1r on RCSB PDB site
Description: Structural Genomics, the crystal structure of a conserved putative protein from Haemophilus influenzae Rd KW20
Class: membrane protein
Keywords: APC85784.2, conserved putative protein, Haemophilus influenzae Rd KW20, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG
Deposited on 2006-11-29, released 2006-12-26
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.176
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: UPF0053 protein HI0107
  Species: Haemophilus influenzae
  Gene: HI0107
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57017 (3-80)
    • cloning artifact (0-2)
    • modified residue (10)
    • modified residue (24)
    • modified residue (71)
  Domains in SCOP 1.75: d2o1ra1
• Chain 'X':
  Compound: Unknown peptide fragment
  Species: synthetic, synthetic
  
• Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2o1rA (A:)
  snaiqqsdgsmiidgsanlrdlnkmfnweldtedartfnglilehleeipdegticeidg
  llitilevgdnmikqakvvkl
  

  
  
• Chain 'X':
  No sequence available.