Lineage for d2i9pa2 (2i9p A:202-332)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334748Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2334807Domain d2i9pa2: 2i9p A:202-332 [204755]
    Other proteins in same PDB: d2i9pa1, d2i9pa3, d2i9pb1, d2i9pb3, d2i9pc1, d2i9pc3, d2i9pd1, d2i9pd3
    automated match to d2cvza1
    complexed with nad

Details for d2i9pa2

PDB Entry: 2i9p (more details), 2.55 Å

PDB Description: crystal structure of human hydroxyisobutyrate dehydrogenase complexed with nad+
PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2i9pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9pa2 a.100.1.0 (A:202-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdtynpvp
gvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakgyskk
dfssvfqflre

SCOPe Domain Coordinates for d2i9pa2:

Click to download the PDB-style file with coordinates for d2i9pa2.
(The format of our PDB-style files is described here.)

Timeline for d2i9pa2: