Lineage for d2i81b_ (2i81 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2488042Species Plasmodium vivax [TaxId:126793] [225142] (2 PDB entries)
  8. 2488044Domain d2i81b_: 2i81 B: [204742]
    automated match to d1uula_

Details for d2i81b_

PDB Entry: 2i81 (more details), 2.45 Å

PDB Description: Crystal Structure of Plasmodium vivax 2-Cys Peroxiredoxin, Reduced
PDB Compounds: (B:) 2-cys peroxiredoxin

SCOPe Domain Sequences for d2i81b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i81b_ c.47.1.0 (B:) automated matches {Plasmodium vivax [TaxId: 126793]}
tyvgkeapffkaeavfgdnsfgevnltqfigkkyvllyfypldftfvcpseiialdkald
afhernvellgcsvdskythlawkktplakggignikhtllsditksiskdynvlfddsv
slrafvlidmngivqhllvnnlaigrsvdeilriidaiqhhekygdvcpanwqkgkvsmk
pseegvaqylstl

SCOPe Domain Coordinates for d2i81b_:

Click to download the PDB-style file with coordinates for d2i81b_.
(The format of our PDB-style files is described here.)

Timeline for d2i81b_: