Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Funalia trogii [TaxId:76130] [255223] (2 PDB entries) |
Domain d2hrga3: 2hrg A:300-496 [242069] automated match to d1kyaa3 complexed with 4ma, bma, ca, cbs, cu, gol, man |
PDB Entry: 2hrg (more details), 1.58 Å
SCOPe Domain Sequences for d2hrga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hrga3 b.6.1.0 (A:300-496) automated matches {Funalia trogii [TaxId: 76130]} vesalttlegtaapgspapggvdlalnmafgfaggkftingasftpptvpvllqilsgaq saqdllpsgsvyslpanadieislpataaapgfphpfhlhghtfavvrsagsstynyenp vyrdvvstgspgdnvtirfrtdnpgpwflhchidfhleagfavvmaedipevaatnpvpq awsdlcptydalspddq
Timeline for d2hrga3: