Lineage for d2gu2a1 (2gu2 A:4-310)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loopsSuperfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) 
core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
Family c.56.5.7: AstE/AspA-like [142526] (3 proteins)
Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229)Protein Aspartoacylase AspA [159649] (2 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [159650] (1 PDB entry)
Uniprot Q6AZ03 4-310
Domain d2gu2a1: 2gu2 A:4-310 [147177]
complexed with so4, zn
Details for d2gu2a1
PDB Entry: 2gu2 (more details), 1.8 Å
PDB Description: crystal structure of an aspartoacylase from rattus norvegicus
PDB Compounds: (A:) Aspa proteinSCOPe Domain Sequences for d2gu2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gu2a1 c.56.5.7 (A:4-310) Aspartoacylase AspA {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cvaeepikkiaifggthgneltgvflvthwlkngaevhraglevkpfitnpravekctry
idcdlnrvfdlenlskemsedlpyevrraqeinhlfgpknsddaydvvfdlhnttsnmgc
tlilgdsgndfliqmfhyiktcmaplpcsvyliehpslkyattrsiakypvgievgpqph
gvlradildqmrrmlkhaldfiqrfnegkefppcaidvykimekvdyprnesgdvaavih
pnlqdqdwkplhpgdpvfvsldgkviplggdctvypvfvneaayyekkeafakttkltln
aksirst
SCOPe Domain Coordinates for d2gu2a1:
Click to download the PDB-style file with coordinates for d2gu2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gu2a1:
- d2gu2a1 first appeared in SCOP 1.75
- d2gu2a1 appears in SCOPe 2.03
- d2gu2a1 appears in SCOPe 2.05
- d2gu2a1 appears in the current release, SCOPe 2.08
View in 3D
