Class a: All alpha proteins [46456] (285 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.5: HP0062-like [158414] (1 family) (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
Family a.25.5.1: HP0062-like [158415] (2 proteins) Pfam PF09647 |
Protein Hypothetical protein HP0062 [158416] (1 species) |
Species Helicobacter pylori [TaxId:210] [158417] (1 PDB entry) Uniprot O24902 4-80 |
Domain d2gtsa1: 2gts A:4-80 [147176] |
PDB Entry: 2gts (more details), 2.1 Å
SCOPe Domain Sequences for d2gtsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtsa1 a.25.5.1 (A:4-80) Hypothetical protein HP0062 {Helicobacter pylori [TaxId: 210]} vqmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkstfne fdeaaqeqiawlkerir
Timeline for d2gtsa1: