Lineage for d2gtsa1 (2gts A:4-80)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1486884Superfamily a.25.5: HP0062-like [158414] (1 family) (S)
    (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 1486885Family a.25.5.1: HP0062-like [158415] (2 proteins)
    Pfam PF09647
  6. 1486886Protein Hypothetical protein HP0062 [158416] (1 species)
  7. 1486887Species Helicobacter pylori [TaxId:210] [158417] (1 PDB entry)
    Uniprot O24902 4-80
  8. 1486888Domain d2gtsa1: 2gts A:4-80 [147176]

Details for d2gtsa1

PDB Entry: 2gts (more details), 2.1 Å

PDB Description: Structure of Protein of Unknown Function HP0062 from Helicobacter pylori
PDB Compounds: (A:) hypothetical protein HP0062

SCOPe Domain Sequences for d2gtsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtsa1 a.25.5.1 (A:4-80) Hypothetical protein HP0062 {Helicobacter pylori [TaxId: 210]}
vqmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkstfne
fdeaaqeqiawlkerir

SCOPe Domain Coordinates for d2gtsa1:

Click to download the PDB-style file with coordinates for d2gtsa1.
(The format of our PDB-style files is described here.)

Timeline for d2gtsa1: