![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (156 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [187746] (23 PDB entries) |
![]() | Domain d2gesa_: 2ges A: [164672] automated match to d1esma_ complexed with cok |
PDB Entry: 2ges (more details), 2.4 Å
SCOPe Domain Sequences for d2gesa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gesa_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} sepspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqv aarqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvd lvttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydi ipgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrt tafadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsi nrlrlrkl
Timeline for d2gesa_: