Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein Zn metallo-beta-lactamase [56283] (12 species) |
Species Xanthomonas maltophilia [TaxId:40324] [56286] (13 PDB entries) |
Domain d2fu9a_: 2fu9 A: [134112] automated match to d1smla_ complexed with gol, mp2, so4, zn |
PDB Entry: 2fu9 (more details), 1.8 Å
SCOPe Domain Sequences for d2fu9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fu9a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga kaltckayadaaeqkfdgqlaketag
Timeline for d2fu9a_: