Lineage for d2ffia1 (2ffi A:10-280)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
Pfam PF04909; Amidohydrolase; stand-alone domain
Protein Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 [141820] (1 species) Species Pseudomonas putida [TaxId:303] [141821] (1 PDB entry)
Uniprot Q88M75 10-280
Domain d2ffia1: 2ffi A:10-280 [133385]
complexed with po4
Details for d2ffia1
PDB Entry: 2ffi (more details), 2.61 Å
PDB Description: Crystal Structure of Putative 2-Pyrone-4,6-Dicarboxylic Acid Hydrolase from Pseudomonas putida, Northeast Structural Genomics Target PpR23.
PDB Compounds: (A:) 2-pyrone-4,6-dicarboxylic acid hydrolase, putativeSCOPe Domain Sequences for d2ffia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ffia1 c.1.9.15 (A:10-280) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]}
lhltaidshahvfsrglnlasqrryapnydaplgdylgqlrahgfshgvlvqpsflgtdn
ryllsalqtvpgqlrgvvmlerdveqatlaemarlgvrgvrlnlmgqdmpdltgaqwrpl
lerigeqgwhvelhrqvadipvlvralqpygldividhfgrpdarrglgqpgfaelltls
grgkvwvkvsgiyrlqgspeenlafarqalcaleahygaerlmwgsdwphtqhesevsfg
saveqfealgcsaqlrqallldtaralfgfe
SCOPe Domain Coordinates for d2ffia1:
Click to download the PDB-style file with coordinates for d2ffia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ffia1:
- d2ffia1 first appeared in SCOP 1.73
- d2ffia1 appears in SCOPe 2.02
- d2ffia1 appears in SCOPe 2.04
- d2ffia1 appears in the current release, SCOPe 2.08
View in 3D
