Lineage for d2f66a1 (2f66 A:322-385)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2304155Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (4 families) (S)
    forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin
  5. 2304156Family a.2.17.1: VPS23 C-terminal domain [140112] (1 protein)
    automatically mapped to Pfam PF09454
  6. 2304157Protein Vacuolar protein sorting-associated protein 23, VPS23 [140113] (1 species)
  7. 2304158Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140114] (3 PDB entries)
    Uniprot P25604 322-385! Uniprot P25604 325-383
  8. 2304161Domain d2f66a1: 2f66 A:322-385 [133027]
    Other proteins in same PDB: d2f66a2, d2f66b1, d2f66c1, d2f66d3, d2f66e_, d2f66f_
    complexed with so4

Details for d2f66a1

PDB Entry: 2f66 (more details), 2.8 Å

PDB Description: structure of the escrt-i endosomal trafficking complex
PDB Compounds: (A:) suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease

SCOPe Domain Sequences for d2f66a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f66a1 a.2.17.1 (A:322-385) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdglnqlynlvaqdyaltdtiealsrmlhrgtipldtfvkqgrelarqqflvrwhiqrit
spls

SCOPe Domain Coordinates for d2f66a1:

Click to download the PDB-style file with coordinates for d2f66a1.
(The format of our PDB-style files is described here.)

Timeline for d2f66a1: