Lineage for d2elba2 (2elb A:274-374)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323359Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1323360Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1323361Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1323416Protein DCC-interacting protein 13-alpha, APPL1 [159211] (1 species)
  7. 1323417Species Human (Homo sapiens) [TaxId:9606] [159212] (1 PDB entry)
    Uniprot Q9UKG1 274-374
  8. 1323418Domain d2elba2: 2elb A:274-374 [146896]
    Other proteins in same PDB: d2elba1

Details for d2elba2

PDB Entry: 2elb (more details), 2.6 Å

PDB Description: Crystal Structure of the BAR-PH domain of human APPL1
PDB Compounds: (A:) Adapter protein containing PH domain, PTB domain and leucine zipper motif 1

SCOPe Domain Sequences for d2elba2:

Sequence, based on SEQRES records: (download)

>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnarnktglvsstwdrqfyftqggnlmsqargdvagglamdidncsvmav
dcedrrycfqitsfdgkkssilqaeskkdheewictinnis

Sequence, based on observed residues (ATOM records): (download)

>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnarnktgtwdrqfyftqggnlmsqargdvamdidncsvmavdcedrryc
fqitsfdgkkssilqaeskkdheewictinnis

SCOPe Domain Coordinates for d2elba2:

Click to download the PDB-style file with coordinates for d2elba2.
(The format of our PDB-style files is described here.)

Timeline for d2elba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2elba1