Lineage for d2djja1 (2djj A:6-121)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484464Family c.47.1.2: PDI-like [52849] (3 proteins)
    duplication: contains two tandem repeats of this fold
  6. 2484477Protein Protein disulfide isomerase, PDI [52850] (5 species)
  7. 2484483Species Fungus (Humicola insolens) [TaxId:34413] [142357] (3 PDB entries)
    Uniprot P55059 227-355! Uniprot P55059 350-459
  8. 2484485Domain d2djja1: 2djj A:6-121 [131547]
    Other proteins in same PDB: d2djja2
    domain A' only, corresponds to the 4th domain of yeast PDI (2B5E)

Details for d2djja1

PDB Entry: 2djj (more details)

PDB Description: solution structure of the a' domain of thermophilic fungal protein disulfide isomerase
PDB Compounds: (A:) Protein disulfide-isomerase

SCOPe Domain Sequences for d2djja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungus (Humicola insolens) [TaxId: 34413]}
egpvtvvvaknyneivlddtkdvliefyapwcghckalapkyeelgalyaksefkdrvvi
akvdatandvpdeiqgfptiklypagakgqpvtysgsrtvedlikfiaengkykaa

SCOPe Domain Coordinates for d2djja1:

Click to download the PDB-style file with coordinates for d2djja1.
(The format of our PDB-style files is described here.)

Timeline for d2djja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2djja2