Class a: All alpha proteins [46456] (289 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) |
Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins) intertwined homodimer of 3-helical subunits |
Protein Chorismate mutase domain of P-protein [48602] (2 species) |
Species Thermus thermophilus [TaxId:274] [140937] (2 PDB entries) Uniprot Q5SLA5 3-82 |
Domain d2d8ea_: 2d8e A: [131331] automated match to d2d8da1 |
PDB Entry: 2d8e (more details), 1.75 Å
SCOPe Domain Sequences for d2d8ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d8ea_ a.130.1.1 (A:) Chorismate mutase domain of P-protein {Thermus thermophilus [TaxId: 274]} eriqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenp gpfpdetirklfkeifkasldleerqdq
Timeline for d2d8ea_: