Lineage for d2d4ha2 (2d4h A:284-316)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338252Fold a.114: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48339] (1 superfamily)
    multihelical; bundle of longer and shorter helices
  4. 2338253Superfamily a.114.1: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48340] (2 families) (S)
    automatically mapped to Pfam PF02841
  5. 2338262Family a.114.1.0: automated matches [230517] (1 protein)
    not a true family
  6. 2338263Protein automated matches [230518] (1 species)
    not a true protein
  7. 2338264Species Human (Homo sapiens) [TaxId:9606] [230519] (6 PDB entries)
  8. 2338273Domain d2d4ha2: 2d4h A:284-316 [241502]
    Other proteins in same PDB: d2d4ha1, d2d4hb1
    automated match to d2b8wb2
    complexed with 5gp

Details for d2d4ha2

PDB Entry: 2d4h (more details), 2.9 Å

PDB Description: crystal-structure of the n-terminal large gtpase domain of human guanylate binding protein 1 (hgbp1) in complex with gmp
PDB Compounds: (A:) interferon-induced guanylate-binding protein 1

SCOPe Domain Sequences for d2d4ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4ha2 a.114.1.0 (A:284-316) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggiqvngprleslvltyvnaissgdlpcmenav

SCOPe Domain Coordinates for d2d4ha2:

Click to download the PDB-style file with coordinates for d2d4ha2.
(The format of our PDB-style files is described here.)

Timeline for d2d4ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d4ha1