Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein) duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family |
Protein Aspartokinase [143391] (3 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143394] (1 PDB entry) Uniprot Q9LYU8 388-478! Uniprot Q9LYU8 479-553 |
Domain d2cdqa3: 2cdq A:420-494 [130292] Other proteins in same PDB: d2cdqa1, d2cdqb1 complexed with lys, sam, tar |
PDB Entry: 2cdq (more details), 2.85 Å
SCOPe Domain Sequences for d2cdqa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} raiislignvqhsslilerafhvlytkgvnvqmisqgaskvnisfivneaeaegcvqalh ksffesgdlselliq
Timeline for d2cdqa3: