Lineage for d2c5wb1 (2c5w B:266-650)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450599Protein Penicillin-binding protein 1a, transpeptidase domain [144034] (1 species)
  7. 1450600Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [144035] (2 PDB entries)
    Uniprot Q8DR59 266-650! Uniprot Q8DR59 267-650
  8. 1450601Domain d2c5wb1: 2c5w B:266-650 [129958]
    complexed with cl, edo, pcz, zn

Details for d2c5wb1

PDB Entry: 2c5w (more details), 2.55 Å

PDB Description: penicillin-binding protein 1a (pbp-1a) acyl-enzyme complex (cefotaxime) from streptococcus pneumoniae
PDB Compounds: (B:) penicillin-binding protein 1a

SCOPe Domain Sequences for d2c5wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5wb1 e.3.1.1 (B:266-650) Penicillin-binding protein 1a, transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
snypaymdnylkevinqveeetgynllttgmdvytnvdqeaqkhlwdiyntdeyvaypdd
elqvastivdvsngkviaqlgarhqssnvsfginqavetnrdwgstmkpitdyapaleyg
vyestativhdepynypgtntpvynwdrgyfgnitlqyalqqsrnvpavetlnkvglnra
ktflnglgidypsihysnaissnttesdkkygassekmaaayaafanggtyykpmyihkv
vfsdgsekefsnvgtramkettaymmtdmmktvltygtgrnaylawlpqagktgtsnytd
eeienhiktsqfvapdelfagytrkysmavwtgysnrltplvgngltvaakvyrsmmtyl
segsnpedwnipeglyrngefvfkn

SCOPe Domain Coordinates for d2c5wb1:

Click to download the PDB-style file with coordinates for d2c5wb1.
(The format of our PDB-style files is described here.)

Timeline for d2c5wb1: