SCOPe 2.08: Domain d2bnqe1: 2bnq E:2-113

Lineage for d2bnqe1 (2bnq E:2-113)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
Domain d2bnqe1: 2bnq E:2-113 [144998]
Other proteins in same PDB: d2bnqa1, d2bnqa2, d2bnqb2, d2bnqb3, d2bnqd2, d2bnqe2

Details for d2bnqe1

PDB Entry: 2bnq (more details), 1.7 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines

PDB Compounds: (E:) T-cell receptor beta chain c region

SCOPe Domain Sequences for d2bnqe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnqe1 b.1.1.1 (E:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassyvgntgelffgegsrltvle

SCOPe Domain Coordinates for d2bnqe1:

Click to download the PDB-style file with coordinates for d2bnqe1.
(The format of our PDB-style files is described here.)

Timeline for d2bnqe1: