Lineage for d2a6tb1 (2a6t B:95-243)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428504Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1428505Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1428780Family d.113.1.7: mRNA decapping enzyme-like [143777] (2 proteins)
    part of Pfam PF00293
  6. 1428781Protein mRNA decapping enzyme Dcp2p catalytic domain [143778] (1 species)
  7. 1428782Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [143779] (1 PDB entry)
    Uniprot O13828 95-245
  8. 1428784Domain d2a6tb1: 2a6t B:95-243 [197737]
    Other proteins in same PDB: d2a6ta1
    automated match to d2a6ta2

Details for d2a6tb1

PDB Entry: 2a6t (more details), 2.5 Å

PDB Description: Crystal structure of S.pombe mRNA decapping enzyme Dcp2p
PDB Compounds: (B:) spac19a8.12

SCOPe Domain Sequences for d2a6tb1:

Sequence, based on SEQRES records: (download)

>d2a6tb1 d.113.1.7 (B:95-243) mRNA decapping enzyme Dcp2p catalytic domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ripvrgaimldmsmqqcvlvkgwkassgwgfpkgkidkdesdvdcairevyeetgfdcss
rinpnefidmtirgqnvrlyiipgisldtrfesrtrkeiskiewhnlmdlptfkknkpqt
mknkfymvipflaplkkwikkrnianntt

Sequence, based on observed residues (ATOM records): (download)

>d2a6tb1 d.113.1.7 (B:95-243) mRNA decapping enzyme Dcp2p catalytic domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ripvrgaimldmsmqqcvlvkwgfpkgkidkdesdvdcairevyeetgfdcssrinpnef
idmtirgqnvrlyiipgisldtrfeiskiewhnlmdlptfkmknkfymvipflaplkkwi
kkrnianntt

SCOPe Domain Coordinates for d2a6tb1:

Click to download the PDB-style file with coordinates for d2a6tb1.
(The format of our PDB-style files is described here.)

Timeline for d2a6tb1: