Lineage for d2a19c_ (2a19 C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1674829Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1674830Protein automated matches [190417] (19 species)
    not a true protein
  7. 1674960Species Human (Homo sapiens) [TaxId:9606] [187294] (476 PDB entries)
  8. 1675482Domain d2a19c_: 2a19 C: [162647]
    Other proteins in same PDB: d2a19a1, d2a19a2
    automated match to d2java1
    complexed with anp, mg, po4

Details for d2a19c_

PDB Entry: 2a19 (more details), 2.5 Å

PDB Description: pkr kinase domain- eif2alpha- amp-pnp complex.
PDB Compounds: (C:) Interferon-induced, double-stranded RNA-activated protein kinase

SCOPe Domain Sequences for d2a19c_:

Sequence, based on SEQRES records: (download)

>d2a19c_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
htvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalakld
hvnivhyngcwdgfdydpetssknssrsktkclfiqmefcdkgtleqwiekrrgekldkv
lalelfeqitkgvdyihskklinrdlkpsniflvdtkqvkigdfglvtslkndgkrtrsk
gtlrymspeqissqdygkevdlyalglilaellhvcdtafetskfftdlrdgiisdifdk
kektllqkllskkpedrpntseilrtltvwkk

Sequence, based on observed residues (ATOM records): (download)

>d2a19c_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
htvdkrfgmdfkeieligsggfgqvfkakhridgktyvikrvkynnekaerevkalakld
hvnivhyngcwdgfdydpetsktkclfiqmefcdkgtllalelfeqitkgvdyihskkli
nrdlkpsniflvdtkqvkigdfglvgkevdlyalglilaellgiisdifdkkektllqkl
lskkpedrpntseilrtltvwkk

SCOPe Domain Coordinates for d2a19c_:

Click to download the PDB-style file with coordinates for d2a19c_.
(The format of our PDB-style files is described here.)

Timeline for d2a19c_: