Lineage for d1z2bb2 (1z2b B:246-438)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1657767Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1657768Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1657861Protein Tubulin beta-subunit [55313] (2 species)
  7. 1657862Species Cow (Bos taurus) [TaxId:9913] [64322] (5 PDB entries)
    Uniprot P02554
  8. 1657866Domain d1z2bb2: 1z2b B:246-438 [144728]
    Other proteins in same PDB: d1z2ba1, d1z2ba2, d1z2bb1, d1z2bc1, d1z2bc2, d1z2bd1, d1z2be1
    complexed with cn2, gdp, gtp, mg, vlb

Details for d1z2bb2

PDB Entry: 1z2b (more details), 4.1 Å

PDB Description: Tubulin-colchicine-vinblastine: stathmin-like domain complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d1z2bb2:

Sequence, based on SEQRES records: (download)

>d1z2bb2 d.79.2.1 (B:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d1z2bb2 d.79.2.1 (B:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsltvpeltqqmfdsknmmaacdprhgryl
tvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfigns
taiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda

SCOPe Domain Coordinates for d1z2bb2:

Click to download the PDB-style file with coordinates for d1z2bb2.
(The format of our PDB-style files is described here.)

Timeline for d1z2bb2: