Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein HslV (ClpQ) protease [56258] (4 species) dodecameric prokaryotic homologue of proteasome |
Species Bacillus subtilis [TaxId:1423] [160845] (2 PDB entries) Uniprot P39070 2-181 |
Domain d1yyfc1: 1yyf C:2-181 [144719] Other proteins in same PDB: d1yyfa1, d1yyfb1 complexed with adp |
PDB Entry: 1yyf (more details), 4.16 Å
SCOPe Domain Sequences for d1yyfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yyfc1 d.153.1.4 (C:2-181) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
Timeline for d1yyfc1: