Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
Species Deinococcus radiodurans [TaxId:1299] [117896] (2 PDB entries) Uniprot Q9RUV2 |
Domain d1y67a2: 1y67 A:98-213 [116497] Other proteins in same PDB: d1y67a1, d1y67b1, d1y67c1, d1y67d1 complexed with fe |
PDB Entry: 1y67 (more details), 1.85 Å
SCOPe Domain Sequences for d1y67a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y67a2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} nqpsgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplm geaiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaaklv
Timeline for d1y67a2: