Lineage for d1x07a_ (1x07 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628315Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 1628316Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 1628317Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
    automatically mapped to Pfam PF01255
  6. 1628352Protein automated matches [190121] (3 species)
    not a true protein
  7. 1628356Species Escherichia coli [TaxId:562] [186844] (9 PDB entries)
  8. 1628368Domain d1x07a_: 1x07 A: [121545]
    automated match to d1jp3a_
    complexed with ipe, mg, po4

Details for d1x07a_

PDB Entry: 1x07 (more details), 2.2 Å

PDB Description: Crystal structure of undecaprenyl pyrophosphate synthase in complex with Mg and IPP
PDB Compounds: (A:) Undecaprenyl pyrophosphate synthetase

SCOPe Domain Sequences for d1x07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x07a_ c.101.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
seklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlya
fssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksea
ltagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapv
dlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

SCOPe Domain Coordinates for d1x07a_:

Click to download the PDB-style file with coordinates for d1x07a_.
(The format of our PDB-style files is described here.)

Timeline for d1x07a_: