Lineage for d1ww4a_ (1ww4 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390314Species Agrocybe cylindracea [TaxId:64608] [225007] (7 PDB entries)
  8. 2390333Domain d1ww4a_: 1ww4 A: [203033]
    automated match to d2r0hb_

Details for d1ww4a_

PDB Entry: 1ww4 (more details), 2.3 Å

PDB Description: agrocybe cylindracea galectin complexed with neuaca2-3lactose
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d1ww4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ww4a_ b.29.1.0 (A:) automated matches {Agrocybe cylindracea [TaxId: 64608]}
ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
tviqytkqisgttsslsynstegtsifstvveavtytgla

SCOPe Domain Coordinates for d1ww4a_:

Click to download the PDB-style file with coordinates for d1ww4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ww4a_: