Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
Species Rice (Oryza sativa) [TaxId:4530] [118017] (1 PDB entry) Uniprot P18567 |
Domain d1wdds_: 1wdd S: [114532] Other proteins in same PDB: d1wdda1, d1wdda2, d1wdde1, d1wdde2 complexed with cap, gol, mg |
PDB Entry: 1wdd (more details), 1.35 Å
SCOPe Domain Sequences for d1wdds_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdds_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} mqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspgy ydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykpp gc
Timeline for d1wdds_: