Lineage for d1w26a3 (1w26 A:132-247)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857508Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 857509Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 857662Protein Trigger factor PPIase domain [75388] (3 species)
  7. 857663Species Escherichia coli [TaxId:562] [89881] (3 PDB entries)
    Uniprot P22257
  8. 857664Domain d1w26a3: 1w26 A:132-247 [109087]
    Other proteins in same PDB: d1w26a1, d1w26a2, d1w26b1, d1w26b2

Details for d1w26a3

PDB Entry: 1w26 (more details), 2.7 Å

PDB Description: trigger factor in complex with the ribosome forms a molecular cradle for nascent proteins
PDB Compounds: (A:) Trigger Factor

SCOP Domain Sequences for d1w26a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w26a3 d.26.1.1 (A:132-247) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]}
vtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgq
grmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpe

SCOP Domain Coordinates for d1w26a3:

Click to download the PDB-style file with coordinates for d1w26a3.
(The format of our PDB-style files is described here.)

Timeline for d1w26a3: