Lineage for d1vmea1 (1vme A:251-398)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2464624Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2464728Protein ROO-like flavoprotein TM0755, C-terminal domain [110466] (1 species)
  7. 2464729Species Thermotoga maritima [TaxId:2336] [110467] (1 PDB entry)
    Uniprot Q9WZL4
  8. 2464730Domain d1vmea1: 1vme A:251-398 [108893]
    Other proteins in same PDB: d1vmea2, d1vmea3, d1vmeb2, d1vmeb3
    Structural genomics target
    complexed with cl, edo, feo

Details for d1vmea1

PDB Entry: 1vme (more details), 1.8 Å

PDB Description: Crystal structure of Flavoprotein (TM0755) from Thermotoga maritima at 1.80 A resolution
PDB Compounds: (A:) Flavoprotein

SCOPe Domain Sequences for d1vmea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsaertagellketkfri
lsfteikgsnmderkieeaisllkkele

SCOPe Domain Coordinates for d1vmea1:

Click to download the PDB-style file with coordinates for d1vmea1.
(The format of our PDB-style files is described here.)

Timeline for d1vmea1: