Lineage for d1ukvg2 (1ukv G:400-446)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meanderSuperfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) 
Family c.3.1.3: GDI-like N domain [51931] (2 proteins)
Similar to FAD-linked reductases in both domains but does not bind FADProtein Guanine nucleotide dissociation inhibitor, GDI [51932] (2 species)
the inhibition function is probably associated with an insert subdomain, residues 120-220
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110439] (2 PDB entries) 
Domain d1ukvg2: 1ukv G:400-446 [107916]
Other proteins in same PDB: d1ukvg3, d1ukvy_
complexed with gdp, ger, mg
Details for d1ukvg2
PDB Entry: 1ukv (more details), 1.5 Å
PDB Description: Structure of RabGDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
PDB Compounds: (G:) Secretory pathway GDP dissociation inhibitorSCOP Domain Sequences for d1ukvg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukvg2 c.3.1.3 (G:400-446) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
predgskdniylsrsydasshfesmtddvkdiyfrvtghplvlkqrq
SCOP Domain Coordinates for d1ukvg2:
Click to download the PDB-style file with coordinates for d1ukvg2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ukvg2:
- d1ukvg2 first appeared in SCOP 1.69
- d1ukvg2 appears in SCOP 1.71
- d1ukvg2 appears in SCOP 1.75
- d1ukvg2 appears in the current release, SCOPe 2.08
View in 3D
