| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) ![]() |
| Family c.3.1.3: GDI-like N domain [51931] (2 proteins) Similar to FAD-linked reductases in both domains but does not bind FAD |
| Protein Guanine nucleotide dissociation inhibitor, GDI [51932] (2 species) the inhibition function is probably associated with an insert subdomain, residues 120-220 |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110439] (1 PDB entry) |
| Domain d1ukvg2: 1ukv G:400-446 [107916] Other proteins in same PDB: d1ukvg3, d1ukvy_ |
PDB Entry: 1ukv (more details), 1.5 Å
SCOP Domain Sequences for d1ukvg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukvg2 c.3.1.3 (G:400-446) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae)}
predgskdniylsrsydasshfesmtddvkdiyfrvtghplvlkqrq
Timeline for d1ukvg2: