Lineage for d1uhsa_ (1uhs A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1257873Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1257956Protein Homeodomain-only protein, Hop [109647] (1 species)
  7. 1257957Species Mouse (Mus musculus) [TaxId:10090] [109648] (2 PDB entries)
    Uniprot Q8R1H0
  8. 1257959Domain d1uhsa_: 1uhs A: [107853]

Details for d1uhsa_

PDB Entry: 1uhs (more details)

PDB Description: solution structure of mouse homeodomain-only protein hop
PDB Compounds: (A:) homeodomain only protein

SCOPe Domain Sequences for d1uhsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]}
gsegaatmtedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrrs
eglpsecrsvtd

SCOPe Domain Coordinates for d1uhsa_:

Click to download the PDB-style file with coordinates for d1uhsa_.
(The format of our PDB-style files is described here.)

Timeline for d1uhsa_: