Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (43 PDB entries) Uniprot P01901 22-299 |
Domain d1t0ma2: 1t0m A:1-181 [112200] Other proteins in same PDB: d1t0ma1, d1t0mb_, d1t0md1, d1t0me_ |
PDB Entry: 1t0m (more details), 2 Å
SCOPe Domain Sequences for d1t0ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0ma2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]} gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll r
Timeline for d1t0ma2:
View in 3D Domains from other chains: (mouse over for more information) d1t0mb_, d1t0md1, d1t0md2, d1t0me_ |