Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins) eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site automatically mapped to Pfam PF00812 |
Protein Ephrin-a5 [110105] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [110106] (2 PDB entries) Uniprot O08543 |
Domain d1shwa_: 1shw A: [105562] Other proteins in same PDB: d1shwb_ complexed with zn |
PDB Entry: 1shw (more details), 2.2 Å
SCOPe Domain Sequences for d1shwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1shwa_ b.6.1.5 (A:) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} vadryavywnssnprfqrgdyhidvcindyldvfcphyedsvpedkteryvlymvnfdgy sacdhtskgfkrwecnrphspngplkfsekfqlftpfslgfefrpgreyfyissaipdng rrsclklkvfvrptnscm
Timeline for d1shwa_: