Lineage for d1s70a_ (1s70 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440476Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1440477Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1440548Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1440574Protein Protein phosphatase-1 (PP-1) [56311] (5 species)
  7. 1440592Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (2 PDB entries)
    Uniprot P37140 1-308
  8. 1440595Domain d1s70a_: 1s70 A: [105316]
    Other proteins in same PDB: d1s70b_
    complexed with mn, pge

Details for d1s70a_

PDB Entry: 1s70 (more details), 2.7 Å

PDB Description: complex between protein ser/thr phosphatase-1 (delta) and the myosin phosphatase targeting subunit 1 (mypt1)
PDB Compounds: (A:) Serine/threonine protein phosphatase PP1-beta (or delta) catalytic subunit

SCOPe Domain Sequences for d1s70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s70a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
hmadgelnvdslitrllevrgcrpgkivqmteaevrglciksreiflsqpilleleaplk
icgdihgqytdllrlfeyggfppeanylflgdyvdrgkqsleticlllaykikypenffl
lrgnhecasinriygfydeckrrfniklwktftdcfnclpiaaivdekifcchgglspdl
qsmeqirrimrptdvpdtgllcdllwsdpdkdvqgwgendrgvsftfgadvvskflnrhd
ldlicrahqvvedgyeffakrqlvtlfsapnycgefdnaggmmsvdetlmcsfqilkpse
kkakyqygg

SCOPe Domain Coordinates for d1s70a_:

Click to download the PDB-style file with coordinates for d1s70a_.
(The format of our PDB-style files is described here.)

Timeline for d1s70a_: