Lineage for d1repc2 (1rep C:144-246)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1478787Family a.4.5.10: Replication initiation protein [46816] (3 proteins)
    duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry
  6. 1478788Protein RepE54 [46817] (1 species)
  7. 1478789Species Escherichia coli, mini-F plasmid [TaxId:562] [46818] (2 PDB entries)
  8. 1478791Domain d1repc2: 1rep C:144-246 [16126]
    protein/DNA complex; complexed with mg

Details for d1repc2

PDB Entry: 1rep (more details), 2.6 Å

PDB Description: crystal structure of replication initiator protein repe54 of mini-f plasmid complexed with an iteron dna
PDB Compounds: (C:) protein (replication initiation protein)

SCOPe Domain Sequences for d1repc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1repc2 a.4.5.10 (C:144-246) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
nrftqfrlsetkeitnpyamrlyeslcqyrkpdgsgivslkidwiieryqlpqsyqrmpd
frrrflqvcvneinsrtpmrlsyiekkkgrqtthivfsfrdit

SCOPe Domain Coordinates for d1repc2:

Click to download the PDB-style file with coordinates for d1repc2.
(The format of our PDB-style files is described here.)

Timeline for d1repc2: