![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein Enoyl-ACP reductase [51791] (11 species) |
![]() | Species Escherichia coli [TaxId:562] [51794] (13 PDB entries) |
![]() | Domain d1qsgg_: 1qsg G: [29941] complexed with glc, nad, tcl |
PDB Entry: 1qsg (more details), 1.75 Å
SCOPe Domain Sequences for d1qsgg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsgg_ c.2.1.2 (G:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis gevvhvdggfsiaamnele
Timeline for d1qsgg_: