Lineage for d1pz9b_ (1pz9 B:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.4: Laminin G-like module [49944] (7 proteins) 
Protein Agrin [101641] (1 species)
alternative splicingSpecies Chicken (Gallus gallus) [TaxId:9031] [101642] (4 PDB entries) 
Domain d1pz9b_: 1pz9 B: [95412]
Details for d1pz9b_
PDB Entry: 1pz9 (more details), 2.8 Å
PDB Description: Modulation of agrin function by alternative splicing and Ca2+ binding
PDB Compounds: (B:) AgrinSCOPe Domain Sequences for d1pz9b_:
Sequence, based on SEQRES records: (download)
>d1pz9b_ b.29.1.4 (B:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]}
daeaiafdgrtymeyhnavtkshlsneipaekalqsnhfelsikteatqglilwsgkgle
rsdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapi
tgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedal
nnptilhcsak
Sequence, based on observed residues (ATOM records): (download)
>d1pz9b_ b.29.1.4 (B:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]}
daeaiafdgrtymeyhnavtkshlpaekalqsnhfelsikteatqglilwsgkglersdy
ialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapitgss
plgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedalnnpt
ilhcsak
SCOPe Domain Coordinates for d1pz9b_:
Click to download the PDB-style file with coordinates for d1pz9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pz9b_:
- d1pz9b_ first appeared in SCOP 1.67
- d1pz9b_ appears in SCOPe 2.03
- d1pz9b_ appears in SCOPe 2.05
- d1pz9b_ appears in the current release, SCOPe 2.08
View in 3D
